McDonnell Genome Institute

Washington University

CircRNA

chr14|59726918|59746481|-|RTN1|ENST00000267484.9

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9967

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

ILHILLEFFR

Amino Acids from 5' Exons

NHLLQNPRGKAASPRMSSPPSKKQRDYRMKPPRTHGRWASWPTGPRSRPGPDRQPSPAPWTTRPAARSRGTQRSSWCPRTPWPRRTRCPQAMALATWAARRPRPPRHPSSTASGRSARPSWTASSSSSRATPPRPRRRAPSGSRTHPRSPAPWMPSGRRLASGPRSVRQAGGAWPSRVPSSTTPQLSPSLAPSCPLETEPWSLRRPCCHGSLKKTRVPTKVLRPQRALGLVLAPRPHCCFSISKK,TICCRIPGERQHLRGADHRHQRSKGIIVNRREPTAGGPAGRQARGQGQVRTANHPQPPGPRGQQRGVGGLRDRAGVRGPHGRGGRAALRLCELWPRGRPAALARLAIHPVQHPEGGARGRAGQRAHHRVVRRLLGLGGEPQAGAGLTPDEAQRPGCHPGGDWRPGRGACAKPAGPGRAGFLPRLPLNAPAWPRAAPWRRSPGADAHVATEARRLEFQPKSCGHKGPWASRSWRPAPTAVSQAK,PSAAESQGKGSISEDELITAIKEAKGLSYETAENPRPVGQLADRPEVKARSGPPTIPSPLDHEASSAESGDSEIELVSEDPMAAEDALPSGYVSFGHVGGPPPSPASPSIQYSILREEREAELDSELIIESCDASSASEESPKREQDSPPMKPSALDAIREETGVRAEERAPSRRGLAEPGSFLDYPSTEPQPGPELPPGDGALEPETPMLPRKPEEDSSSNQSPAATKGPGPLGPGAPPPLLFLNKQK

Amino Acids from 3' Exons

VWQVFPVPWTTPSQQHQKMGKDRVTHLSFLTSAIHLRRILHILLEFFRRKMATSPFQRALRSWVHPAPPYQMCLGSLVAYLVLILERLLQSPRKTRSQTLWTRKQRPINTLTPDPRRSTKNNITPSWKIKTWTLRIKTLTSQLNLKESVNLTNQLLWREKSSRTIYWKNPHLLHTMISLKNSAGLLRSPPLSKSHRKNLLLKPLPKRRPLRSKIYVSQVLTQSPLSLSRSLKTTAQDLSPLHLLEQ,CGRCFQCHGPHLLNNIKRWGRIVLHISHFHLLSTSGGFYIFYWNSSEGKWPRHHFREPGAGYTRPLLTRCAWDRVSWLIFFWNRDDSCRVHGSEQDLSRPSGPDESRGLIHHNQTRGGEAPRTTSPRAGRRLGLERHHLNTRSPTQTSSCGGKNHQGPFIGRIHICSIHRSLRTAQGSSDHHPCQNHTDGNRTFCNHYPREDPEARYMSKAKSHSPHCHCLGARRQPRIYHPSIFWN,VAGVSSAMDHTFSTTSKDGEGSCYTSLISDICYPPQEDSTYFTGILQKENGHVTISESPEELGTPGPSLPDVPGIESRGLFSSDSGIEMTPAESTEVNKILADPLDQMKAEAYKYIDITRPEEVKHQEQHHPELEDKDLDFKNKDTDISIKPEGVREPDKPAPVEGKIIKDHLLEESTFAPYIDDLSEEQRRAPQITTPVKITLTEIEPSVETTTQEKTPEKQDICLKPSPDTVPTVTVSEPEDDSPGSITPPSSGT