McDonnell Genome Institute

Washington University

CircRNA

chr14|59563736|59572813|-|CCDC175|ENST00000281581.5

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9829

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

5

Peptide

ETVTVSAAEEMRK

Amino Acids from 5' Exons

INEFENTREVKRMETYQKKKELDKLQTKMSKIKETVTVSAA,LMNLKIPVKREWRLIKRRKNWINYKLKCQKKKQLLFPQ,IKYPSKENGDLSKEERIGITNNVKNKRNSYCFRS

Amino Acids from 3' Exons

EEMRKATIDLLEIESMELNKLYYLLETLPNSIKRELE,KKEKPQSIFWRLKAWNSTNYTIYWKLFPIALRGNWK,RNEKSHNRSFGDKHGTQQTILSIGNSSQHEGIG