McDonnell Genome Institute

Washington University

CircRNA

chr14|59330500|59363782|+|DAAM1|ENST00000360909.7

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9081

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

DLSTMSYNR

Amino Acids from 5' Exons

STMSYNRNWKRKNENVMLRLKRRKRCRPIKKRNLKRRLLSISKSSSRWRTSQHSSMSSA,AQATTETGKERTRMCDSREGRDDADLKNERETKGDYAASQAAGGGPHSTAPAQQ,HNELQQKLEKKERECDAKTQEKEEMMQTLNKMKEKLEKETTEHKQVKQQVADLTAQLHELSR

Amino Acids from 3' Exons

ELEYQKSQPPQPGDKFVSVVSQFITVASFSFSDVEDLLAEAKDL,SWNIRSLSPHSPEISLCLLSASSSQPASASLMLKTFQKLKT,AGISEVSAPTARRVCVCCQPVHHSSQLQLLCRPSSRSRP