McDonnell Genome Institute

Washington University

CircRNA

chr14|58223621|58232267|+|ACTR10|ENST00000254286.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9129

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

8

Peptide

ANCVAWLGAR

Amino Acids from 5' Exons

RVLALVISEDKSKQQNLILMGIM,AYLLCKSEARTKNPSSKIYWE,RTCFVSDLKRGLKIQAAKFNIDGNNE

Amino Acids from 3' Exons

CPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKALGTKTFRIHTPPAKANCVAWLG,VRTPGSNQRIWSVALLCCQDFSTDCLQKGIWKNQNIKKHLALRHFEFILHLQKLIVWPGWE,SDRHQEATSREFGSHRWHFYVARISPQIACRNKVFGRKTKIKSTWHDISNSYSTCKSLCGLVG