McDonnell Genome Institute

Washington University

CircRNA

chr14|57222307|57233883|-|EXOC5|ENST00000340918.11

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9221

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

5

Peptide

QDLLGAYLR

Amino Acids from 5' Exons

LSDPSDLPRNAFRIFTILVEFLCIEHIDYALETGLA,SLILLTYQGMPSEFLPFLWNFYVLSILIMLWKQDLL,LSFLTKECLQNFYHSCGIFMYAYLCFGNRTC

Amino Acids from 3' Exons

GAYLRNDIFEDAGILCQRVNKQVGDIFSNPETVLAKLIQNVFEIKLQ,VLIEMIYLKTLEYSVKETNKLEISSVIQKQSWLNLFKMYLKSNY,CLFEKYIRRWNTLSKSEQTSWRYLQSRNSPGTYSKCINQTT