McDonnell Genome Institute

Washington University

CircRNA

chr14|55158521|55183753|-|DLGAP5|ENST00000247191.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9346

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

LFSGAMK

Amino Acids from 5' Exons

KKVVSGIASKPKQDDAGRIAARNRLAAIKNAMRERIRQEECAETAVSVIPKEVDKIVFDAGFFRVESPVKLFS,KKLSQVQVNQNRMMLEELQREIALPKMQERELGRKNVLKQQFLYQRKLIKCSMLDFSELKVLLNYSQ,KSCLRYSKTKTGCWKNCSEKSPSCHKKCNERENAGRMCNSSFCDTKGSNSVRCWIFQSKSCIIL

Amino Acids from 3' Exons

GQKLFVINENRCSKNTKKKSNFKNKSRERKLNEEYLKWVVIDLICLVFFYQTRMLKLSQK,GNENYSRSTKTDAPKIQRRKATSKIERAERESTRNISGSLTYALFSFIKPECCESAKK,AMKTILGDQRKQMLQKYKEEKQLQKLKEQREKAKRGIFKVGRYRPDMPCFLLSNQNAVKAEPKK