McDonnell Genome Institute

Washington University

CircRNA

chr14|55158521|55177336|-|DLGAP5|ENST00000247191.6

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9127

28

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

MLDFSELK

Amino Acids from 5' Exons

KKVVSGIASKPKQDDAGRIAARNRLAAIKNAMRERIRQEECAETAVSVIPKEVDKIVFDAGFFRVESPVKLFS,KKLSQVQVNQNRMMLEELQREIALPKMQERELGRKNVLKQQFLYQRKLIKCSMLDFSELKVLLNYSQ,KSCLRYSKTKTGCWKNCSEKSPSCHKKCNERENAGRMCNSSFCDTKGSNSVRCWIFQSKSCIIL

Amino Acids from 3' Exons

GISCKVDSEENTLNSQTNATSGMNPDGVLSKMENLPEINTAKIKGKNSFAPKDFMFQPLDGLKTYQVTPMTPRSANAFLTPSYTWTPLKTE,VFLVKSIVKKILIHKLMQQVEIQMESYQKWKTYLRILQKKGRIPLHLRILCFSHWMVRPIKHLLPEVPMLFHPVTPGLLKQK,YFLSRRKYFEFTNCNKWNESRWSLIKNGKLTDKYCKNKREEFLCTGFYVSATGWSEDLSSNTYDSQKCQCFFDTQLHLDSFKNRS