McDonnell Genome Institute

Washington University

CircRNA

chr14|55158521|55175472|-|DLGAP5|ENST00000247191.6

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9438

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

5

Peptide

LFSEHVLNK

Amino Acids from 5' Exons

KKVVSGIASKPKQDDAGRIAARNRLAAIKNAMRERIRQEECAETAVSVIPKEVDKIVFDAGFFRVESPVKLFS,KKLSQVQVNQNRMMLEELQREIALPKMQERELGRKNVLKQQFLYQRKLIKCSMLDFSELKVLLNYSQ,KSCLRYSKTKTGCWKNCSEKSPSCHKKCNERENAGRMCNSSFCDTKGSNSVRCWIFQSKSCIIL

Amino Acids from 3' Exons

NMFIKMKLLLKIMAFQKKSHHLKEMKVELLSPTMVCHIS,TCFKKSYYKFKWPSNKRSPITKKRSNCSAPPWCAIFQ,HVLNKNEATTKNLNGLPIKEVPSLERNEGRIAQPHHGVPYF