McDonnell Genome Institute

Washington University

CircRNA

chr14|55061679|55063325|+|MAPK1IP1L|ENST00000395468.8

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9994

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

15

Peptide

IPHQDSILLPVILSK

Amino Acids from 5' Exons

ENVIF,KMSDEFS,KCLMNF

Amino Acids from 3' Exons

LADALPEHSPAKTSAVSNTKPGQPPQGWPGSNPWNNPSAPSSVPSGLPPSATPSTVPFGPAPTGMYPSVPPTGPPPGPPAPFPPSGPSCPPPGGPYPAPTVPGPGPTGPYPTPNMPFPELPRPYGAPTDPAAAGPLGPWGSMSSGPWAPGMGGQYPTPNMPYPSPGPYPAPPPPQAPGAAPPVPWGTVPPGAWGPPAPYPAPTGSYPTPGLYPTPSNPFQVPSGPSGAPPMPGGPH,WQMHYLNTPLPKPLLAIQNLANLLKAGQAPTLGIIRVLHLQCHLDSHQVQHPPLCLLDQHQQECIPPCLPPDHLQDPQHPFLLPDHHVPHLVVLIQPQLCRALAPQGHILHQICPFQSYPDHMVHPQIQLQLVLVHGDPCLLDLGRQEWEGSILPLICHIHLQAHIPLLLLPKPLGQHHLFHGAPFHQEPGDHQHHILPLQDRIPHQDSILLPVILSKCLQDLLVLHQCLVAP,GRCTTTLPCQNLCCEQYKTWPTSSRLARLQPLESECSIFSAIWTPTKCNTLHCAFWTSTNRNVSLRASHRTTSRTPSTLSSFRTIMSPTWWSLSSPNCAGPWPHRAISYTKYALSRATQTIWCTHRSSCSWSFRSMGIHVFWTLGARNGRAVSYPYAISISRPISRSSSSPSPWGSTTCSMGHRSTRSLGTTSTISCPYRIVSHTRTLSYSQSFPSAFRTFWCSTNAWWPP