McDonnell Genome Institute

Washington University

CircRNA

chr14|52874176|52881469|-|FERMT2|ENST00000341590.7

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9983

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

LNLLTTLK

Amino Acids from 5' Exons

GDITSIPELADYIKVF,VTLLPFLNLLTTLKFS,HYFHSTCLHSFQ

Amino Acids from 3' Exons

EVYIQAQDCIVKQPPLMMLMMEAPCHQLLLGLVTVLCQKAILVYLLSVNQSRHQKSWQKCSSLKLFLIKQKSTK,KYIFKPRTVNNDPHLCSWKPLVTNFCLVWQCFVRRQSWYTCCQSTNHVTRNLGKNVQASSSSSKNQPR,SIYSSPGLYSKTMTPTYDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMFKPQALLDKAKINQ