McDonnell Genome Institute

Washington University

CircRNA

chr14|52864400|52874226|-|FERMT2|ENST00000341590.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9983

20

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

14

Peptide

NKQGDITSIPELADYIK

Amino Acids from 5' Exons

EKQYAHWMAACRLASKGKTMADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDITPECLVSPRYLKKYKNKQ,KNSMHTGWQPADPPKARPWRTVLTTKFRIFFPFRCSITQILSYQSRSRLILLNVWCLPAIKSIRTS,KTVCTLDGSLQISLQRQDHGGQFLQLRSSEYSFLSEDAAFKPRSSVNTRADHDYNSMFGVSPLSKKVEQA

Amino Acids from 3' Exons

GDITSIPELADYIKVF,VTLLPFLNLLTTLKFS,HYFHSTCLHSFQ