McDonnell Genome Institute

Washington University

CircRNA

chr14|52439203|52440724|-|TXNDC16|ENST00000281741.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9961

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

6

Peptide

LEAGLENHITGNHCGK

Amino Acids from 5' Exons

KEYSSGERNLEGIFSSASPSSSCFGESAFRWPSICISFRPGYNRKPCIVAEEIRSRTRKSY,KNTPVGRGILRAYFDPLPPLPLLVLVNLHSGGQVFAFPSDQAIIEENLVLWLKKLEAGLENHI,RILQWGEESGHILILCLPFLFLFWICIQVAKYLHFLQTRLLKKTLYCGRNKQDKIIS

Amino Acids from 3' Exons

PEITVENLPSYFRLQKPLLILFSDGTVNPQYKKAILTLVKQKYLDSFTPCWLN,RKSLWKIFPVISDFRNHYFCSVMALILSIKKQYHWSRNTWIHLLHAGI,GNHCGKSSQLFQTSETIIDFVQWHCKSSVKSNIDTGKAEILGFIYSMLVKS