McDonnell Genome Institute

Washington University

CircRNA

chr14|50735515|50743529|-|NIN|ENST00000245441.9

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9673

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

LDEQLMELAK

Amino Acids from 5' Exons

VSQMNSLEQELETIHLENEGLKKKQVKLDEQLME,SVRIPLNKNKQFIWKMKAKRNKNWMSSSW,QSDEFPTRIRNNSFGKRPEKETSKTGAAHG

Amino Acids from 3' Exons

LAKSSLLEHRIATMKQEQKSWEHQSASLKSQLVASQEK,WQNQVFSIELRRSRNRNPGNIRVRASHSWWLLRK,GKIKSFRANCDDEAGTEILGTSECELKVTAGGFSGK