McDonnell Genome Institute

Washington University

CircRNA

chr14|50644743|50665619|-|SAV1|ENST00000324679.4

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9928

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

14

Peptide

SYAFIHPAWSNNSK

Amino Acids from 5' Exons

VLGELLLHLEILTMVLKIYPFLLAGLWTGQEGENIIIITQIQLTGAILLSEKDFLLDGNELSHPNLEPIMITQIRRPNTGIPVLL,YWESCCYIFRKFDPWFRFTPSSWLVCGLDNEREKILYRSHKYNSLEPSSARRTSSWMGTSVIRIWNLLCRSHKEGPIQASLCS,IGRVAATSLGNLTNHGSEDLPLPPGWSVDWTMRGRKYYIDHNTNTTHWSHPLEREGLPPGWERVESSEFGTYYVDHTNKKAQYRHPCAP

Amino Acids from 3' Exons

ILCLHSSGMVQQFQDELISVFQIQALMPFQLLEMFQETRVSLELQFKEHLMKEEKATDYLHLLILPEVQMSLESMVLLSHLRKLVLLLKMETLVPDIIIQTIFLMVRESGHLEIVHMKTTDIMNTTMISSKECHRIRGGMLQ,SYAFIHPAWSNNSKTNYLSSRFKPCLFNFWRCSFKKPEFPNSNSKNTSNNEKRKQQIICTFLSCQKSSRCPRVWFFSVICNGSFCCKWRLWFPILLFRQFFWSEKAATWRSCTRLQILIQPSLPKNATESGEACF,LMPSFIRHGPTIPRRTDICLPDSSPNAFSTSGDVVSRNQSFLRTPIQRTPHEIMRRESNRLSAPSYLARSLADVPREYGSSQSFVTEVSFAVENGDSGSRYYYSDNFFDGQRKRPLGDRAHEDYRYYEYNHDLFQRMPQNQGRHAS