McDonnell Genome Institute

Washington University

CircRNA

chr14|45068423|45071798|+|FAM179B|ENST00000361462.6

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9981

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

LLIFDAFK

Amino Acids from 5' Exons

IFDAFKSRLHDSNSKVNLVALETMHKMIPLLRDHLSPIINMLIPAIVDNNLNSKNPGIYAAATNVVQALSQHV,FLMLLNLDFMILIVKIWWLWKQCTKFLYLETTYLLSTCFQQWITIIPRIQASMRLLQMLFRHVSM,FCFISTSFSKSGGSGNNAQNDSSTRPLISYNQHANSSNSGQSEFQESRHLCGCYKCCSGTESAC

Amino Acids from 3' Exons

TITYFYSHFAQKLSFMEKQNRTRKSLL,QLLTSTAILHKSSVFKWKSKTGHDGKAC,NYLLLQPFCTKAQFLNGKAKQDMTEKLA