McDonnell Genome Institute

Washington University

CircRNA

chr14|39085761|39091713|-|SEC23A|ENST00000307712.10

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9851

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

3

Peptide

SSGVALSIAVGLLER

Amino Acids from 5' Exons

ILTTSTENRHESHRSSGRTPARPLACTTGKETFAFLWGGTFHSCRTAG,FLQPVQKIDMNLTDLLGELQRDPWPVPQGKRPLRSSGVALSIAVGLLE,SYNQYRKTISQIFWENSSETLGLYHRERDLCVPLGWHFPLDCW

Amino Acids from 3' Exons

RGPQMPLIFLYVVDTCMEDEDLQALKESMQMSLSLLPPTALVGLITFGRMVQVHELGCEGISKSYVFRGTKDLSAKQLQ,VVLRCLYSSMWLILAWKMKIYKPKNPCRCHVFYHLQLWLDLLLLGEWFRFMNLDVKAFQKAMSSEEQKICLPNNC,WSSDAFDIPLCGYLHGRRFTSPERIHADVIKSFTTYSFGWTYYFWENGSGSTWMRHFKKLCLQRNKRFVCQTTA