top of page

McDonnell Genome Institute

Washington University

CircRNA

chr14|39045162|39064993|-|SEC23A|ENST00000307712.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9812

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

24

3

Peptide

QDLTQSLIMIQPILYAYSFSGPPETSR

Amino Acids from 5' Exons

FMFHLRRSSFLQVFNNSPDESSYYRHHFMRQDLTQSLIMIQPILYAYSFSGPPE,LCFIEDLLSCKFLTIVLMRVHIIVTILCVKIPSLLFSLSCMRILLVDHQ,YVSFKKIFFPASFQSEFILSSPFYASRSDPVSNYDSAYPVCVFFWTTR

Amino Acids from 3' Exons

TSREIKISGAIGPCVSLNSKGPCVSEN,PQGKRFQELLDPVCHSILKDPVCLK,LKGNKDFRSYWTLCVTQFRTLCVK

bottom of page