McDonnell Genome Institute

Washington University

CircRNA

chr14|35266726|35270596|+|KIAA0391|ENST00000250377.11

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9101

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

4

Peptide

LTFQLLNVVSQLAKR

Amino Acids from 5' Exons

LLNVVSQLAKRNLRLLVLGRKHMLRRSSQWSRDEMEEVQKQASCFFADD,SMSSLNPNGICDCWSAGSTCDGVPSGVGMRWKRCKSKPAVFLLMT,LECRLSTSQTESATAGPRPEAHAKTEFPVESGDGRGAKASQLFFCH

Amino Acids from 3' Exons

LGGSIPSVCHTALRESLQVYHKRPDAGPQGLSACQDPTPVFVAAGTSAGNCKVSRIKTNLS,SEDDPFLLYATLHSGNHCRFITRDLMRDHKACLPDAKTQRLFFKWQQGHQLAIVNRFPGSKLTFQ,RRMIHSFCMPHCTPGITAGLSQETCGTTRPVCLMPRPNACFLSGSRDISWQLIGFQDQNPF