McDonnell Genome Institute

Washington University

CircRNA

chr14|35122951|35127611|+|KIAA0391|ENST00000250377.11

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9217

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

2

Peptide

ENSPAFLLLSSPK

Amino Acids from 5' Exons

VHELECKRHQRIPALSPGLRLATLDIPGLLFNRENSPAFLLLSSPKSRTLICLGRNTNLLKSSTSTLHRRPPISLILPKRGFFNISLTIWCSHCIMTFYLFGIRSFPKLWKSPYLGLGPGHSYVSLFLADRCGIRNQQRLFSLKTMSPQNTKATNLIAKARYLRKDEGSNKQVYSVPHFFLAGAAKERSQMNSQTEDHALAPVRNTIQLPTQPLNSEEWDKLKEDLKENTGKTSFESWIISQMAGCHSSIDVAKSLLAWVAAKNNGIVSYDLLVKYLYLCVFHMQTSEVIDVFEIMKARYKTLEPRGYSLLIRGLIHSDRWREALLLLEDIKKVITPSKKNYNDCIQGALLHQDVNTAWNLYQELLGHDIVPMLETLKAFFDFGKDIKDDNYSNKLLDILSYLRNNQLYPGESFAHSIKTWFE,FMNWNVRGTRGFLLCPLVCGLRRWTSPDCCLIEKTHLPSCFVAPKAEPFVCKEETQTFKVPLRLCTADPQSLFCHRRGVFSTSLSLSGADLTALSICLVFEAFRSFGRAHTLGAQGTLMSRCFWQTAVASGTSRGCFLLKQCLHRIPKQRILPRPDISGKMRAVISKFILFLIFFLEQLRRDHRILKLKIMPWHLGTLFNSQHNLIQRSGINLRKIKKTPERPVSKVGSFHRWLAVIALMWLNLCWHGQPKIMVLVTIYWSSICISVSFICRHLKLLMSLKLKPDIRLNLEVTVFSSGDSIQTDGEKHCCCRTSKKLLLQKRTIMTVSRELSFIKMTQLGIYIRNCVMILFLCWKLKLSLILEKTRMITIQINYIFFHIEIISCIQGSHLHTVKHGLR,STGMEAPEDSCSVPWFAACDVGHPRIVVRKLTCLLAFKPQKQNLDLSVRKKHKPFKKFHFDSAPPTPNLFNFAIEEGFFQHLSHYLVLISLHNDFLFVWYSKLSEALEEPIPWARPRALLCLAVSGRPLWHQEPAEVVFSNNVSTEYQSNESDCQGQISQERGQASLFCSSFFFSWSSGEITDEFSNRSCLGTCEEHYSTPNTTFEFRGVGTGRFKRKHRKDQFRKLDHFTDGWLSLYRCGISAGMGSSQKWYCKLRFTGQVFVSLCLSYADISYCLNYESQIDFRTRLQSSHPGIDPFRQMERSIVAVRGHQKSYNSFKKELLYPGSSPSSRCKHSLEFISGIARSYCSYVGNFKSFLFWKRHKGLFKTTRYSFISKKSAVSRGVICTQYKNMVE

Amino Acids from 3' Exons

WPVFGLWKNHRVYSAESRRIMSGKNHEGCDRWRPVQKDNTS,GQCSGCGKTIESIQLSPEEYECLKGKIMRDVIDGGDQYRKTTPQ,ASVRAVEKPSLFSVQKNMNVLREKSGMMEVTSTERQHL