McDonnell Genome Institute

Washington University

CircRNA

chr14|35099251|35116737|-|PPP2R3C|ENST00000261475.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9946

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

8

Peptide

TEKKSEQELK

Amino Acids from 5' Exons

DLENYILELIPTLPQLDGLEKSFYSFYVCTAVRKFFFFLDPLRT,IKTTYWNLSLRCHNMVWKNLSTPFMFVQQLGSSSSFILEQ,FRKLHIGTYPYVATIRWSGKIFLLLLCLYSSEVLLLFRSFKN

Amino Acids from 3' Exons

KKKVNKNKMKKWIYLQNITPNGKEVEKTQMNSIRPFPGFII,KKKTRIKRRNGFIYKILLRMERRKKHKILDHSPVLL,KKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFYYR