McDonnell Genome Institute

Washington University

CircRNA

chr14|35046504|35053451|+|FAM177A1|ENST00000382406.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9711

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

2

Peptide

QQPCGGDDDGPGASGR

Amino Acids from 5' Exons

RQQPCGGDDDGPGASGRCGTRRSRRSLGSCGRRGIRGICRA,ASSPVVATTMDQEPVGGVERGEAVAASGAAAAAAFGESAGQ,PAALWWRRRWTRSQWAVWNEEKPSQPRELRPPRHSGNLQG

Amino Acids from 3' Exons

MSNERGFENVELGVIGKKKKVPRRVIHFVSGETMEEYSTDEDEVDGLEKKDVLPTVDP,VTKEALKMNWESEKRRKSQGESSTLLVVKQWKNIAQMKTKLMAWRRKMFCLLLI,ERKRLKCRTGSHRKKEESPKESHPLCWNNGRIHRRRSWPGEERCFAYCS