McDonnell Genome Institute

Washington University

CircRNA

chr14|35011508|35013494|+|SRP54|ENST00000216774.10

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9995

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

17

6

Peptide

GGGALSAYTEMDPVIIASEGVEK

Amino Acids from 5' Exons

LYRNGSCHHCFRSREIKKFNYYCYKWPPQTRRLFVRNASSCCY,YTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAI,IQKWILSSLLLKERNLKMKILKLLLLIQVAATNKKTLCLKKCFKLLML

Amino Acids from 3' Exons

QPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALS,NLITLFMWMPPLGRLVKPRLRLLKIKMPQQNLMAMQKEVVHSV,THCLCDGCLHWAGLSPGGFRSRCSLSNSDKTWPCKRRWCTQC