McDonnell Genome Institute

Washington University

CircRNA

chr14|35000935|35013494|+|SRP54|ENST00000216774.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9947

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

6

Peptide

GGGALSASAIDLEEMASGLNK

Amino Acids from 5' Exons

VCYSRDGIWSQKKNDSACCIRTCE,SAIDLEEMASGLNKRKMIQHAVFKELVK,LLLILKRWHLVLTKEKFSMLYLKNL

Amino Acids from 3' Exons

QPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALS,NLITLFMWMPPLGRLVKPRLRLLKIKMPQQNLMAMQKEVVHSV,THCLCDGCLHWAGLSPGGFRSRCSLSNSDKTWPCKRRWCTQC