McDonnell Genome Institute

Washington University

CircRNA

chr14|34800223|34874662|-|BAZ1A|ENST00000358716.8

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9595

33

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

GSGAGAGGR

Amino Acids from 5' Exons

LLKRLNKEKKQMPKRRKKKKKIKRKRGKNKKLLKKRDRKKKKKRGLKKEK,FKGIKKRKSRCPRSEEKRKRRREKEGRIEKNCRRETKEKRRKREASRKRK,FEKAKLKREKADALEAKKKEKEDKEKKREELKKIVEEERLKKKEEKERLKVEREK

Amino Acids from 3' Exons

GSGAGAGGRGSRRARGRTGDAAATPKAVCETEAARGPAARRGSFLLSHQRDLPPLR,EAGPARAAEGPGEPAGGREMPLLHRKPFVRQKPPADLRPDEEVFYCKVTNEIFRHY,KRGRRGRPRVQASPRADGRCRCYTESRLDRSRPRTCGPTRKFSTVKSPTRSSATT