McDonnell Genome Institute

Washington University

CircRNA

chr14|31562067|31826714|+|NUBPL|ENST00000281081.11

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9695

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

5

Peptide

RVHVPLSGAGSETLK

Amino Acids from 5' Exons

LSGAGSETLKQRRTQIMSRGLPKQKPIEGVKQVIVVASGKGGVGKSTTA,CLAPGVRPNKEEHKSCPEDFQSRNRKVLNKLLWLLERVESENLLQQ,VWRREDPKTKKNTNHVPRTSKAETDRRCTSYSCGFWKGWSRKIYYS

Amino Acids from 3' Exons

VLLSPRPRTSHWMHTRVLRCFAESTC,CCDCLHAPGHRIDGCTQGCDVSQSPRA,AVIVSTPQDIALMDAHKGAEMFRRVHVP