McDonnell Genome Institute

Washington University

CircRNA

chr14|31386419|31394226|-|HEATR5A|ENST00000543095.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9979

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

6

Peptide

YSVSLNFR

Amino Acids from 5' Exons

MPVMVIWKPGLVPQMPLANICWFVLYKNLEISYTILAPQRHLCYRIQVQ,CRNEWFGNPAWFHRCSRPTYAGLCFTRTWKSHTQSWHHSGTFATGFKY,AVMSDGNLETRLGSTDVAASQHMLVCALQELGNLIHNLGTTAAPLLQDSST

Amino Acids from 3' Exons

CLLELQNEAIFMWSTDLDSVATLCFKSFEGSNYDVRISVSKLLGIILAKAVISKHPGT,VSLNFRMKPSLCGVRTWTVWPHCVLSPLKVPIMMCGFLFQSYAYLKLFLNIQEQ,SPTSESHLYVEYGPGQCGHTVFVLRFQLCADFCFKVTRHNISSCNFTSRN