McDonnell Genome Institute

Washington University

CircRNA

chr14|31307892|31337614|-|HEATR5A|ENST00000538864.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9716

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

11

Peptide

IGSDQVNLCSPYLLLR

Amino Acids from 5' Exons

ESAWNFYVPYVQMQPWKALLVYMHCKHFMYLGPDQKLAVI,NQRGISMFLTFRCNHGKHNCLFTCIASTSRCTLAQIKNWQS,ISVEFLCSLRSDATMESITACLHALQALLDVPWPRSKIGSDQ

Amino Acids from 3' Exons

VNLCSPYLLLRRAVLACLRQLVQREAAEVSEHAVMLAKDSREELTP,IFVAPTCYEEQYWLAYVSLYKEKQLKFQNMLLCLLRIAEKSLQ,ESLPLLVTEKSSTGLLTSACTKRSSSFRTCCYACGQRRVDS