McDonnell Genome Institute

Washington University

CircRNA

chr14|31149998|31173806|-|HECTD1|ENST00000399332.5

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9337

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

7

Peptide

VDLTVQVSDGALR

Amino Acids from 5' Exons

EDEPQEDAKELQQGKPYHWRDWSIIRGRDCLYIWSDAAALELSNGSNGWFRFILDGKLATMYSSGSPEGGSDSS,KMNHRKMLKNCNKVNHIIGETGQSLGEGTAYIFGVMQQPWNYLMAVMDGSDLSWMENLPPCIQVVVRKVDLTVQ,RTTGRCRIATRTISLERLVNHGKGLLIYLECSSLGIIWQWMVQIYLGWKTCHHVFKWSGRWIQF

Amino Acids from 3' Exons

VSDGALRCFASLADRFTRRGVDPAPLAKHGLTEELLSRMAAAGGTVSGPSSACKPGRSTTGAPSTTADSKLSNQVSTIVSLLSTLCRGSPVVTH,FQMELCDALHHWLTDLPVVVLTQLHPSMDLRSCYLEWLLLVVLFQDHHQHANQVAAPQELHPPLQIPNVIRCQQLVCSQHFAEALRH,FRWSSAMLCITGPIYPSWCPSSISQAWINGAVISNGCCWWYCFRTIISMQTRSQHHRSSIHHCRFQIESGVNNCKSALNTLQRLSGSNT