McDonnell Genome Institute

Washington University

CircRNA

chr14|31134871|31144941|-|HECTD1|ENST00000399332.5

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

21

14

Peptide

DGQNWTSLYTHVDDCSLNEPGYELWLEIYTMTILK

Amino Acids from 5' Exons

NCLMGKSSCLWTCSSNVIRRKKSTLWPLRRHTKSFSFKLSQECLVCHRSGSLGDTISIYTSSCSWLWKVCTEKLGFPGIQRWTELDFFVYPCLQSQTR,TAYEWVNPAAYGLVVVTSSEGRNLPYGRLEDILSRDNSALNCHSNDDKNAWFAIDLGLWVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEP,LLMNGIQLPMDLRHQKEEIYLMAAKTYVVIIQLIVIAMMIRMPGLPIWVSGYHQHIHFVMLVVMEGLHEIGFSRYPKMDRTGLLCIPMLMTAVSMNQ

Amino Acids from 3' Exons

VRTMARDLYDDHFKAVESMPRGVVVTLRNIATQLESSWELHTNRQ,YELWLEIYTMTILKLLKACLVEWHSETQLSSHLGNFIQID,TNYGSRFIRPFSCKHASWSSGNTQKHSNSVRVILGTSYKT