McDonnell Genome Institute

Washington University

CircRNA

chr14|31116235|31123047|-|HECTD1|ENST00000399332.5

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9634

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

IWEPTYTFP

Amino Acids from 5' Exons

GPLIQSSWKKSNVLRHLDLSLKQVLERLVKLNYHSPISDQPSFTMYKNCFNCPVMAMNQINLGVFGSPHT,DPSFRALGRSRMYSVTSISSHFESNRSWNDSSITTHQFQINHLLLCTKIASIVLWQCEIRTAYLGAHIH,TPHSELLEEVECTPSPRLALTLKVTGLGTTREVELPLTNFRSTIFYYVQKLLQLSCNGNVKSDKLRRIWEPTY

Amino Acids from 3' Exons

ISLIAAVPVLYWLSSMMMRTYLSQMKKMMRMKMTIRRTKNTRRL,FPLPCQYSIGARGLTARRRERQSGGPRIRGGY,FLDSCRASTLLAELDDDEDLPEPDEEDDENEDDNQEDQEYEEVM