McDonnell Genome Institute

Washington University

CircRNA

chr14|30906876|30913657|-|STRN3|ENST00000355683.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

11

Peptide

TEPITFPSGGGK

Amino Acids from 5' Exons

SQMFLALLVIQMQFGVLLIVAKINYCLVQQMALLGYGIHKKNCHVFALTMEIK,AKCSSWHFSWSYRCSLGSCLWHKKSITVLFSRWHCVMESTRKIAMYLHLQWR,PNVLAGTLVGHTDAVWGLAYSGIKNQLLSCSADGTVRLWNPQEKLPCICTYNGDK

Amino Acids from 3' Exons

LNQRFHLEEASHLLWVLMMFCVYWALETLQTRQMMQTIVM,TNNVSIWRRQVIYYGFCFVKCTGPWRPCRLDGNKCRLL,EPITFPSGGGKSFIMGSDDVLLSVLGLGDLADLTVTNDADYSYD