McDonnell Genome Institute

Washington University

CircRNA

chr14|30885795|30886312|+|COCH|ENST00000216361.8

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9858

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

9

Peptide

ALQLLHMMQAVCR

Amino Acids from 5' Exons

AVCRNNGFFSYHMPNWFGTTKYVKPLVQKLCTHEQMMCSKTCYNSVNIAFLIDGSSSVGDSNFRLMLEFVSNIAKTFEISDIGAKIAAVQFTYDQRTEFSFTDYSTKENVLAVIRNIRYMSGGTATGDAISFTVRNVFGPIRESPNKNFLVIVTDGQSYDDVQGPAAAAHDA,LSVGIMASSLTTCPTGLAPQNTSLWYRSCALMNKCAARPVITQTLPFLMAPAVLEIAISASCLNLFPTPRLLKSRTLVPRLLYSLLMISARSSVSLTIAPKRMSLSSETSAIVVEQLLVMPFPSLLEMCLALGRAPTRTSLSQMGSPMMMSKALQLLHMMQ,CLSEWLLLLPHAQLVWHHKIRKASGTEAVHSTNDVQQDLLLSEHCLSNWLQQCWRQFPPHAICFQHSQDFNLGHWCQDSCCTVYLSAHGVQFHLHQRECPSCHQKHPLYEWWNSYWCHFLHCKCVWPYKGEPQQELPSNCHRWAVLCPRPCSCCTC

Amino Acids from 3' Exons

AVCRNNGFFSYHMPNWFGTTKYVKPLVQKLCTHEQMMCSKTCYNSVNIAFLIDGSSSVGDSNFRLMLEFVSNIAKTFEISDIGAKIAAVQFTYDQRTEFSFTDYSTKENVLAVIRNIRYMSGGTATGDAISFTVRNVFGPIRESPNKNFLVIVTDGQSYDDVQGPAAAAHDA,LSVGIMASSLTTCPTGLAPQNTSLWYRSCALMNKCAARPVITQTLPFLMAPAVLEIAISASCLNLFPTPRLLKSRTLVPRLLYSLLMISARSSVSLTIAPKRMSLSSETSAIVVEQLLVMPFPSLLEMCLALGRAPTRTSLSQMGSPMMMSKALQLLHMMQ,CLSEWLLLLPHAQLVWHHKIRKASGTEAVHSTNDVQQDLLLSEHCLSNWLQQCWRQFPPHAICFQHSQDFNLGHWCQDSCCTVYLSAHGVQFHLHQRECPSCHQKHPLYEWWNSYWCHFLHCKCVWPYKGEPQQELPSNCHRWAVLCPRPCSCCTC