McDonnell Genome Institute

Washington University

CircRNA

chr14|24301964|24304598|+|NOP9|ENST00000267425.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9783

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

6

Peptide

EIAAELVFITDK

Amino Acids from 5' Exons

CLSLIRSPASVFKWLYRFYTANFPSFALISAMLLATVLAVPQMA,VYHDLQLLSSSGFTGFTPQTSPVLRSSLQCCDWLPEYSRFLSRWQ,FITDKISSFCLQVALQVLHRKLPQFCAHLCNAVIGYLSTRGSSVDG

Amino Acids from 3' Exons

GQYVALACSRHGSRVLDAIWSGAALRARKEIAAEL,DNMWLWPVVAMAAVCMPSGVEQPGPGRKLLLSL,TICGSGLSPWQPCARCHLEWSSLEGPEGNCCA