top of page

McDonnell Genome Institute

Washington University

CircRNA

chr14|24146533|24147221|-|PSME2|ENST00000216802.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.957

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

8

Peptide

QLDQSGTLR

Amino Acids from 5' Exons

LDQSGTLRASPRKSHPAGEPTLAGPNPSRASPAPSPVCPEGRGKTLTQPLPALFELLVLLHPRRSLWLPLPLALISLRPLLAVEPSWGSPATEYPLCHTPTSLTPTLDFQLALAISPAPLRGTAPAPVSAVPLTLAPPSGSPWTVTQPAPPLLVATGWEWLRGYLLLAACQREEGGGKKKGGGVEGGGPGPGEKRKPGRLAGRPEIRLKQHGQAVWGAPERGSPQT,WTSPVRSGPHRGSPTLQGNRLWPALTPLERVPPHLRSVLKAEGRPSPNPCPLSSKSCSFSTPGAPSGCPSHSLSLSVRYLRSSLLGGAPPLNTPFAILPPLLPQPWTSSWPLAPPLSEGQPPLQSPRSHLPPLPRAAPGLPSQHRLSWQLAGNGGATYCLRPASGRRGAERRKGAGLRGAGLDLGSESESPGDPGDQRSSDSSMAKPCGVRLSGEARKQ,GPVRYAPGLTEEVPPCRGTDSGRPPLSSESRPISGLSRQREDPHPTPARSLLRAASPSPPQALPLAAPPTRSDLSPSATCGRAFLGEPRHIPPLPYSHLSYPNPGLPVGPSYKPRPSPRDSPRSSLRGPTYPSPSLGQPLDCDPASTASPSGNWLGMAEGLPTACGLPAGGGGRKEERGRGGGRAWTWGVKAKARATSRETRDLATEAAWPSRVGCAAGKPAN

Amino Acids from 3' Exons

LDQSGTLRASPRKSHPAGEPTLAGPNPSRASPAPSPVCPEGRGKTLTQPLPALFELLVLLHPRRSLWLPLPLALISLRPLLAVEPSWGSPATEYPLCHTPTSLTPTLDFQLALAISPAPLRGTAPAPVSAVPLTLAPPSGSPWTVTQPAPPLLVATGWEWLRGYLLLAACQREEGGGKKKGGGVEGGGPGPGEKRKPGRLAGRPEIRLKQHGQAVWGAPERGSPQT,WTSPVRSGPHRGSPTLQGNRLWPALTPLERVPPHLRSVLKAEGRPSPNPCPLSSKSCSFSTPGAPSGCPSHSLSLSVRYLRSSLLGGAPPLNTPFAILPPLLPQPWTSSWPLAPPLSEGQPPLQSPRSHLPPLPRAAPGLPSQHRLSWQLAGNGGATYCLRPASGRRGAERRKGAGLRGAGLDLGSESESPGDPGDQRSSDSSMAKPCGVRLSGEARKQ,GPVRYAPGLTEEVPPCRGTDSGRPPLSSESRPISGLSRQREDPHPTPARSLLRAASPSPPQALPLAAPPTRSDLSPSATCGRAFLGEPRHIPPLPYSHLSYPNPGLPVGPSYKPRPSPRDSPRSSLRGPTYPSPSLGQPLDCDPASTASPSGNWLGMAEGLPTACGLPAGGGGRKEERGRGGGRAWTWGVKAKARATSRETRDLATEAAWPSRVGCAAGKPAN

bottom of page