McDonnell Genome Institute

Washington University

CircRNA

chr14|24116916|24119896|+|DCAF11|ENST00000326009.9

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9491

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

LGEMMPSAK

Amino Acids from 5' Exons

RPSEVGAGRRCSKFTIHSGPLGLRGREQSLGWSSWGSIQPT,GQVRLVQGGGAANLQFIQALLDSEEENDRAWDGRLGDRYNPP,AKGWCREEVQQIYNSFRPSWTQRKRMTELGMVVLGIDTTHL

Amino Acids from 3' Exons

IESHEDDVNAVAFADISSQILFSGGDDAICKVWDRRTMREDDPKPVGALAGHQDGITFIDSK,LSPMRMMMQWPLLIAPKSCSLGEMMPSAKCGIDAPCGRMTPSLWVHWLDTRMASPSLTA,VPGCECSGLCYKLPNPVLWGRCHLQSVGSTHHAGGPQACGCTGWTPGWHHLHQQ