McDonnell Genome Institute

Washington University

CircRNA

chr14|23061083|23064485|-|ACIN1|ENST00000555053.5

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9714

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

3

Peptide

AAPCIYWLPLTDSQLPR

Amino Acids from 5' Exons

RKPRRNHLPSCWMTFSERPRQLPASIGSHLTA,ESPGGTTCQAAGPFPKDQGSSLHLLAPTDQP,KAQEEPPAKLLDDLFRKTKAAPCIYWLPLTDSQ

Amino Acids from 3' Exons

LPRGCQLETVTQRGASLVGNDAGEPAQPPHRRNLPSVSPLNH,YQGGASWKQHRGGPAWSETTLGSQHSHHTEETFHQYHHITK,TKGVPAGNSDTEGGQPGRKRRWGASTATTQKKPSISITTESLK