McDonnell Genome Institute

Washington University

CircRNA

chr14|22924478|22925040|-|PRMT5|ENST00000216350.12

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9295

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

16

Peptide

RGEGYQCPLEVQFIITGTNHHSEK

Amino Acids from 5' Exons

AIYKCLLDRVPEEEKDTNV,PSINVCTEYQKRRRIPMS,HLMSARPSTRRGEGYQCP

Amino Acids from 3' Exons

LEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQ,WRCSSSSQAPTTTQRRSSAPTSNTWNTARTVLHLMPMNSLPRAMKTICSPRF,GGAVHHHRHQPPLREGVLLLPPIPGILKPEPSSTCLTLCQGLRLSAVPAS