McDonnell Genome Institute

Washington University

CircRNA

chr14|21500494|21501129|-|METTL3|ENST00000298717.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9322

22

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

17

3

Peptide

LNIPVLQDDGFLFLWVTGRR

Amino Acids from 5' Exons

WICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLNIPVLQDDGFLFLWVTG,GSVVISATWTSVSWASLQLWLTHPGIFTWNCPMGPQMMRCAGSTYPYYRMMAFSSSGSQA,DLLYPLPGRQYLGQVCSCDGPTLGYSHGTALWDPDRDAQAQHTRTTGWLSLPLGHRQ

Amino Acids from 3' Exons

TNYQTHVFRLLFPYMFPHGYLQVCSLNCLHGFGPWQQRPHAKPGACSYTECRRFQCRPTLPTS,RIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMDSEAPGSKDHTPSQELALTQSVGGDSSADRLFPPQ,ELSINTLMSLVTALSLIHVSTWIPASMFTMKLMLAWILRPLAAKTTRQARSLLLHRVSEVIPVQTDSSHL