McDonnell Genome Institute

Washington University

CircRNA

chr14|21392506|21393254|-|CHD8|ENST00000399982.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9909

19

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

11

Peptide

DLTSPAQSSMMK

Amino Acids from 5' Exons

DRVLINRIDLVCQAVLSGKWPSSRRSQEMVTGGILGPGNHLLDSPSLTPGEYGDSPVPTPRSSSAASMAEEEASAVSTAAAQFTKLRRGMDEKEFTVQIKD,IVSTVLTSSARLYSQGSGLLAVGARKWQEEFWGQATTCTVPHLLENMVTLQSPHHEVVVQLPWQRRKHLQSAQRQPSSPNFAEAWMKRSLQFKSK,SCPDKPYPRLPGCTLREVAFPEPGNGNRRNFGARQPLARQSLIDSWRIWLSSPHTTKCSFHGRGGSICSQHSGSPVHQTSPRHGKGVYSSNQR

Amino Acids from 3' Exons

LTSPAQSSMMKRVSCPSLCPKMDSQMKMENKPLSFCYCRKDKEPLSGP,PVPLKALRESPVPHYVPRWIPKRWRTNDPASATAGKTKSLVAQ,DQSRSKLYDEESLLSLTMSQDGFPNEDGEQMTPELLLLQERQRASEWPK