McDonnell Genome Institute

Washington University

CircRNA

chr14|21357196|21359609|-|SUPT16H|ENST00000216297.6

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9914

39

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

MCSSTQK

Amino Acids from 5' Exons

PPFVVTLDEVELIHFERVQFHLKNFDMVIVYKDYSKKVTMINAIPVASLDPIKEWL,HLLWHWMRSSTLSGSSFTRTLIWSSTRTTARKPSTPFLPLLTPSRNG,TFCGDIGGRADPLAGPVSPEELYGNRLQGLQQESDHDQRHSCSLSPHQGMVE

Amino Acids from 3' Exons

NAIMFGKKRHTDVQFYTEVGEITTDLGKHQHMHDRDDLYAEQ,MPSCLGRSGTRMCSSTQKWERPRTWGNISICMTEMTSMLS,CHHVWEEAAHGCAVLHRSGRDNHGLGETSAYAPRPLCA