McDonnell Genome Institute

Washington University

CircRNA

chr14|20387904|20396730|-|TEP1|ENST00000262715.9

Cancer

Type of Peptide

BRCA-Basal-like

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9741

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

2

Peptide

LQSMGPPIFWNMWAK

Amino Acids from 5' Exons

VHCRAWGLPSSGTCGPNGQNIQDSTTPRKDRGPVSPATGRGHSKPLGSCFPAR,FIAEHGASHLLEHVGQMDKIFKIPPPPGKTGVQSLRPLEEDTPSPLAPVSQQ,SLQSMGPPIFWNMWAKWTKYSRFHHPQERQGSSLSGHWKRTLQAPWLLFPSK

Amino Acids from 3' Exons

KMGSFPSWPCFGTCATCCGLESVPATMSSFSRDSSM,KWEASLHGHASEPVQPAAGWNQFPPPAHSPETPAC,NGKLPFMAMLRNLCNLLRVGISSRHHELILQRLQHA