McDonnell Genome Institute

Washington University

CircRNA

chr14|105458269|105460953|+|MTA1|ENST00000331320.11

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9447

90

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

9

Peptide

DFTDIQQDFAR

Amino Acids from 5' Exons

ARRMAETSPGWRPRCGRRTTHSQTSRSTSSWWWP,RGGWPRPVQVGDPGVGGAQPTHRQADRPVPGGGP,EEDGRDQSRLETQVWEAHNPLTDKQIDQFLVVA

Amino Acids from 3' Exons

FHAMDTLHKNIYDISKAISALVPQGGPVLCRDEMEEWSASEANLFEEALEKYGKDFTDIQQDF,STPWILSTRTSTTSPRPSRRWCRRAGPCSAGTRWRSGLHQRPTFSRKPWKNMGRISRTFSKI,PRHGYSPQEHLRHLQGHLGAGAAGRARALQGRDGGVVCIRGQPFRGSPGKIWEGFHGHSARF