McDonnell Genome Institute

Washington University

CircRNA

chr14|105445417|105450324|+|MTA1|ENST00000481012.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9961

15

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

7

Peptide

SSPTWSGR

Amino Acids from 5' Exons

TANGNVEAKVVCFYRRRDISSTLIALADKHA,RPMGTWRPKWCASTGGGTSPAPSSPWPTSTQ,GQWERGGQSGVLLPEAGHLQHPHRPGRQAR

Amino Acids from 3' Exons

GKKRKWRTRKWWTCPRNSTSCGIGSCSSPGSWSLCPPRTSGSPQQLPPWAPRAALAFPACPSFSSRGKCSVTLLNETESLKSYLERE,GNRRGNGEPGNGGPARETKAPAAASGAVPLPAAGVSARHAHQVAPSSSRPGPLGLPSPFQPARPSLPGASAASPCSTRPSRSSPTWSG,EIEEEMENPEMVDLPEKLKHQLRHRELFLSRQLESLPATHIRPPAAPALGPSGCPRLSSLPVLLFQGQVQRHPAQRDRVAQVLPGAG