McDonnell Genome Institute

Washington University

CircRNA

chr14|105368458|105384463|+|PACS2|ENST00000551692.5

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9388

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

GVACCVAWR

Amino Acids from 5' Exons

DLDEDDFDVGKPKKQRRSIVRTTSMTR,TWTRTTLTWGSRRSSGDRLERRPP,LGRGRLRGEAEEAAEIDCKNDVHDQ

Amino Acids from 3' Exons

LQLQFPAPDPREDRRGGSAALPQCHPAALCGAAVPQDTRLARLHALPGHPTGAPRRPPGPGHRCHGQCGVAWSGVAWRGVLCGVAWRGVSWCGAVWHGVVSLLATHLLFLNVCLIQHFVNFNYMQDNLIALKQPFGSRSHRPLKGPELGVSSISRCDNSMPVSISKVRSAKQGSLLILSNRPGPVSSNSITSLGPYDVSYHETNPPSLNLLTSSKAWRRHLSRVALTMPTSEPASRGLCTVTCALLGLPQWHSGLWDLSSGLELLQRGHRHPPGRGSGGFLFRWQESGLVWKAAAQAWGRVAQLLCRGGSLAAPSPPWHQPHPWHAGSHPVARYLGSVDYRYNNFFQDLAWRDLFNKLEAQSA,CNCNSQPPTPVKIAVAGAQHYLSAILRLFVEQLSHKTPDWLGYMRFLVIPLGEHHAVHLGLGTDATGSVAWHGVVWRGVACCVAWRGAVCRGVARCGMAWCPCLLHICCFMFVYSNTLLILIICKITLPNSHLGQDKAIALRGLSWVSPPSVAVITLCQFRFPKSEVQSRARYSSQIVQVLCRRTPLLLVHTMCLTTKQTHPALICPAARPGGDTSPVWPSRCRRQSPEPAEASARSHVPCWAFLSGTQGSGTSAQGWSSFSGATGIHQGGAVVAFSFGGRKVGLSGRQQHRPGVGWPSFCAAVGALQLRVPRGDTSPTPGMQAPTPWPGTAPWTTATTTSSRTWPGETCSTSWRPRVR,ATAIPSPRPPRSPWRERSITSVPSCGSLWSSCPTRHPTGSATCASWSSHWVSTTPSTWAWAQMPRAVWRGMEWCGVAWRVVWRGVARCVVVWRGVAWRGVPACYTFVVFKCLFDTVTLCFLYARLDCPKTAIWVKIKPSPSEGAAGCLLHQSLLYASFDFQSQKCKAGLVINPLKSSRSCVVELHYFFRSIRCVLPRNKPTQPSVDQQQGLEATPLPCGPHDADVRALSQPRPLHGHMCPAGPSSVALRALGPQLRAGAPSAGPQASTREGQWWLSLSVAGKWACLEGSSTGLGSGGPAFVPRWEPCSSESPVVTPAPPLACRLPPRGQVPRLRGLPLQQLLPGPGLERPVQQAGGPEC