McDonnell Genome Institute

Washington University

CircRNA

chr14|104701356|104701756|+|INF2|ENST00000330634.11

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9782

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

25

Peptide

LDGAVPGAERPGPAAGGAGAAVGPR

Amino Acids from 5' Exons

LGKMSVKEGAQRKWAALKEKLGPQDSDPTEANLESADPELCIRLLQMPSVVNYSGLRKRLEGSDGGWMVQFLEQSGLDLLLEALARLSGRGVARISDALLQLTCVSCVRAVMNSRQGIEYILSNQGYVRQLSQ,SARCRRRAHSASGQRRRSWGHRIRTPRRPTWRARTPSCASGCSRCPLWSTTPACASAWRAATAAGWCSSWSRAAWTCCWRRWRGCRAAALHVSPTPCCSSPASAACAPSTRGRASSTSSATRATCASSPR,RQDVGEGGRTAQVGSAEGEAGATGFGPHGGQPGERGPRAVHPAAPDALCGQLLRPAQAPGGQRRRLDGAVPGAERPGPAAGGAGAAVGPRRCTYLRRPAAAHLRQLRARRHELAAGHRVHPQQPGLRAPALP

Amino Acids from 3' Exons

LGKMSVKEGAQRKWAALKEKLGPQDSDPTEANLESADPELCIRLLQMPSVVNYSGLRKRLEGSDGGWMVQFLEQSGLDLLLEALARLSGRGVARISDALLQLTCVSCVRAVMNSRQGIEYILSNQGYVRQLSQ,SARCRRRAHSASGQRRRSWGHRIRTPRRPTWRARTPSCASGCSRCPLWSTTPACASAWRAATAAGWCSSWSRAAWTCCWRRWRGCRAAALHVSPTPCCSSPASAACAPSTRGRASSTSSATRATCASSPR,RQDVGEGGRTAQVGSAEGEAGATGFGPHGGQPGERGPRAVHPAAPDALCGQLLRPAQAPGGQRRRLDGAVPGAERPGPAAGGAGAAVGPRRCTYLRRPAAAHLRQLRARRHELAAGHRVHPQQPGLRAPALP