McDonnell Genome Institute

Washington University

CircRNA

chr14|104031107|104034069|+|TDRD9|ENST00000339063.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9991

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

LQSHEVLK

Amino Acids from 5' Exons

QSHEVLKGLFSKSVENMTDGSVPFPMKDDEKYLIRILLESFSTNKLGTPNCK,KAMKFSRASFPSQKTQMALCPFPKTTRNISSGFCRAFLPINWVLQTV,KPSSQGPLFQVSRKHDRWLCALSHERRREISHPDFVRELFYQTGYSKL

Amino Acids from 3' Exons

VCLDEGEHQLCHYQRPRPSPENAGCSFPFHQCD,CVWIEKESINSVIISDAPEDLHQRMLVAASLSINAT,VFGLRRRASTLSLSVTPLKTFTRECWLQLPFPSMRL