McDonnell Genome Institute

Washington University

CircRNA

chr14|104014724|104034069|+|TDRD9|ENST00000339063.6

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.979

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

ECWLQLPFPSMR

Amino Acids from 5' Exons

VAELYEELKTRISQFNMHVDSRRPVMDQEYIYKQRFILQ,WLNYMKNRLESHSSTCMLILGDLSWTKSIYISSDSSY,GIIRIEDNLTVQHACFSATCHGPRVYIAAIHPT

Amino Acids from 3' Exons

VCLDEGEHQLCHYQRPRPSPENAGCSFPFHQCD,CVWIEKESINSVIISDAPEDLHQRMLVAASLSINAT,VFGLRRRASTLSLSVTPLKTFTRECWLQLPFPSMRL