McDonnell Genome Institute

Washington University

CircRNA

chr14|103752999|103754244|-|PPP1R13B|ENST00000202556.13

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9969

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

LYQELQEQR

Amino Acids from 5' Exons

LLKKGSVPCSRKRSRKYRLQFGLISLVSNWKIRKENMGSSLTMANRDQRRWSKDCTKNY,CNRKVQCHVPGKEAGSTDCNFKGSASAIGRFKERKTEWVPVLQWQIDGTSGGGVKKTVPRTT,AEIERFSAMFQEKKQEVQTAILRVDQLSQQLEDLKKGKLNGFQSYNGKLTGPAAVELKRLYQELQ

Amino Acids from 3' Exons

EQRLHFLKQQERRQQQSISENEKLQKLKERVEAQENKLKKIRAMRGQVDYSKIMNGNL,NSVYIFSNRSAVSSSLFLKMKSFRNKNELKPRRTSRKFVQEDKSTTAKSTAIC,TAFTFSKATGAPSAAVYFKKASEIERTSSPGEQAEENSCNERTSRLQQNHERQS