McDonnell Genome Institute

Washington University

CircRNA

chr14|103428386|103468186|+|MARK3|ENST00000303622.13

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9193

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

6

Peptide

DATVTMVAIK

Amino Acids from 5' Exons

VAIKIIDKTQLNPTSLQK,LQKLTKLSIQQVYK,CNKNNQNSVESNKSTK

Amino Acids from 3' Exons

LDASDSSSSSNLSLAKVRPSSDLNNSTGQSPHHKVQRSVSSSQKQRRYSDH,WMLVIPVLAAIFHLLRLGRAVISTTVLASLLTTKCREVFLQAKSKDATVTM,GCFQFQQSFTCGAEQSQQQYWPVSSPQSAEKCFFKPKAKTLQP