McDonnell Genome Institute

Washington University

CircRNA

chr14|103338326|103338893|+|EIF5|ENST00000216554.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9728

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

9

Peptide

VNILFDFVKR

Amino Acids from 5' Exons

RIVTVVQERKKKKRKTERAKTRKMAPYPAVRHHHHHHHQMKLILLHIQ,EQWYRKERKRKEKQKGQRQGKWLRIQQDTTTTTTTKNSSSTYN,NSDSGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTM

Amino Acids from 3' Exons

EEEEDDDWGEDTTEEAQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVK,KKRRMMTGEKIQLRKLKGVEWMKSVTMQKFHSVMIWKEQLRRGSISSLILL,RRGGLGRRYNGSSKASNGNQPCKSSDTQFGKNNGEGQYPLFC